SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015332 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015332
Domain Number 1 Region: 1260-1374
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-34
Family Pleckstrin-homology domain (PH domain) 0.00099
Further Details:      
 
Domain Number 2 Region: 1062-1242
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.24e-19
Family DBL homology domain (DH-domain) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015332   Gene: ENSRNOG00000011129   Transcript: ENSRNOT00000015331
Sequence length 1515
Comment pep:known chromosome:RGSC3.4:15:27413764:27433672:1 gene:ENSRNOG00000011129 transcript:ENSRNOT00000015331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPEPVEDCVQSTLAALYPPFEATAPTLLGQVFQVVERTYQEDALRYTLDFLVPAKHLLAK
VQQEACAQYSGFLFFHEGWPLCLHEQVVVQLAALPWQLLRPGDFYLQVVPSAAQAPRLAL
KCLAPGGGRVQELPVPNEACAYLFTPEWLQGINKDRPTGRLSTCLLSAPSGIQRLPWAEL
VCPRFVHKEGLMVGHQPSTLPPELPSGPPGLPSSPLPEEVLGTRSPGDGHNAPAEGPEGE
YVELLEVTLPVRGSPIDAEASGLSRTRTVPARKTTGGKGRHRRHRAWMNQKGPGSRDQDG
TRPPGEGSSTGASSDSPSGAEADPDAAVLEAPEPPAEASGEASESCLLSGEAVGGVGQGT
EGPPDTPRRTGKGNRRKKRAAGRGAVSRGGESTPLSPRDKEETRQPEVLSLPSPSEQEPV
ECSLVKEKEDSGKPESESKEELKPADEKEPAPPEDYEPPEEGNRESEKEELPPECTAGST
GPEWFPSEPPTQPLETVQDVKEDSIPEETPPVSASDDPLIVWDLMSSGFFILTGGVDQTG
RALLRITPPPPCLPEEPSPSQETLSTALRYLHSLLRPDLQLLGLTILLDLRKVPPLPPAL
LPALSQLQDSGDPPFIQRLLILTHEDPPEELCGFQGAELLSEKDLKRVAKPEELQWDLGG
HRDLSPNHWAEIHQEVARLCTLCQGVLTSVRQAIEELEGAAESKEEESVGMPEPLQKVLA
DPRLTALQRNGGAILMRLRSTHSSKLEGPGPAVLYQEVDEAIHQLVRLSNLRVQQQEQRQ
RLRQVQEVLQWLSGPGEEQLASFTIPGNSLSVLQETELRFRAFSTEVQERLVQAREALAL
EEDITSQKVLDIFEQRLEQVESGLHRALRLQRFFQQAHEWVDEGCARLAGAGPGREAVLA
ALALRRAPEPSAGTFQEMRALALDLGSPAALREWGRCRARCQELERRIQQQLGEEASPRS
HRRRRADSASSAGAQHGAHSPSPSLSSLLLPSSPGPRAAPSHCSLTPCGEDYEEEGLELA
PEADGRPPRAVLIRGLEVTSTEVVDRTCSPREHVLLGRAGGPDGPWGIGTPRMERKRSIS
AQQRLVSELIDCEQEYITTLNEPVPPPGPELTPGLRCTWAAALSVRERLRSFHGTHFLQE
LQGCTAHPLRIGACFLRHGDQFNLYAQFVKHRHKLESGLTALTPSVKGSMEGSPCLPRAL
QQPLEQLARYAQLLEELLREAGPELSSERQALRAAVQLLQEQEARGRDLLAVEAVRGCEI
DLREQGQLLHRDPFTVICGRKKCLRHVFLFEDLLLFSKSKGSEGGSETFVYKQAFKTADM
GLTENIGDSGLCFELWFRRRRAREAYTLQATSPETKLKWTSSIAQLLWRQAAHNKELRVQ
QMVSMGIGNKPFLDIKALGERTLSALLTGRAARTRASVAVSSFEHAGPSLPGLSPGACSL
PARVEEEAWDLDVKQISLASETLDSSGDVSPGPRNSPSLQSPNPGSSTPALSSGGILGLS
RQSHSRALSDPTTPL
Download sequence
Identical sequences ENSRNOP00000015332 10116.ENSRNOP00000037837 ENSRNOP00000037837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]