SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015879 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015879
Domain Number 1 Region: 821-899
Classification Level Classification E-value
Superfamily DEATH domain 3.36e-19
Family DEATH domain, DD 0.0000616
Further Details:      
 
Domain Number 2 Region: 127-218
Classification Level Classification E-value
Superfamily Immunoglobulin 5.93e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 217-267
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000353
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 273-320
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 5 Region: 20-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000143
Family I set domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015879   Gene: ENSRNOG00000011858   Transcript: ENSRNOT00000015879
Sequence length 924
Comment pep:known chromosome:RGSC3.4:16:67422994:67688547:1 gene:ENSRNOG00000011858 transcript:ENSRNOT00000015879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GADSGEVLPDSIPSAPGTLPHFIEEPEDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQ
NEHVSEESLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHLGTSKSRKASVRI
AYLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADH
NLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSWTEWSACNVRCGRGWQK
RSRTCTNPAPLNGGAFCEGMSVQKITCTALCPVDGSWEVWSEWSVCSPECEHLRIRECTA
PPPRNGGKFCEGLSQESENCTDGLCILDKKPLHEIKPQRWSRRGIENASDIALYSGLGAA
VVAVAVLVIGVTLYRRSHSDYGVDVIDSSALTGGFQTFNFKTVRQGNSLLLNPAMHPDLT
VSRTYSGPICLQDPLDKELMTESSLFNPLSDIKVKVQSSFMVSLGVSERAEYHGKNHSGT
FPHGNNRGFSTIHPRNKTPYIQNLSSLPTRTELRTTGVFGHLGGRLVMPNTGVSLLIPHG
AIPEENSWEIYMSINQGEPSLQSDGSEVLLSPEVTCGPPDMLVTTPFALTIPHCADVSSE
HWNIHLKKRTQQGKWEEVMSVEDESTSCYCLLDPFACHVLLDSFGTYALTGEPITDCAVK
QLKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQEVVSDERHQGGQLLEEPKLLHFKGNTFS
LQISVLDIPPFLWRIKPFTACQEVPFSRVWSSNRQPLHCAFSLERYTPTTTQLSCKICIR
QLKGHEQILQVQTSILESERETITFFAQEDSTFPAQTGPKAFKIPYSIRQRICATFDTPN
AKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLWEARHQQDGDLDSLACALEEIGRTH
TKLSNITEPQLDDTDFNYSRQNGL
Download sequence
Identical sequences ENSRNOP00000015879 10116.ENSRNOP00000015879 NYSGRC-IgSF-ENSRNOP00000015879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]