SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016445 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016445
Domain Number 1 Region: 5-172
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.17e-46
Family HD domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016445   Gene: ENSRNOG00000012236   Transcript: ENSRNOT00000016445
Sequence length 179
Comment pep:known chromosome:RGSC3.4:1:136161425:136163710:1 gene:ENSRNOG00000012236 transcript:ENSRNOT00000016445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEAAQLLEAADFAAQKHRQQRRKDPEGTPYINHPIGVARILTHEAGITDIVVLQAALL
HDTVEDTDTTLDEVELHFGAQVRRLVEEVTDDKTLPKLERKRQQVEQAPHSSPGAKLVKL
ADKLHNLRDLNRCTPKGWSEHRVQEYFEWAAQVVKGLQGTNQQLEEALKQLFEERGLTL
Download sequence
Identical sequences D4A500
ENSRNOP00000016445 NP_001100998.1.100692 NP_001100998.1.4139 10116.ENSRNOP00000016445 ENSRNOP00000016445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]