SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017429 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017429
Domain Number 1 Region: 3-61
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000196
Family TNF receptor-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017429   Gene: ENSRNOG00000013018   Transcript: ENSRNOT00000017429
Sequence length 297
Comment pep:known chromosome:RGSC3.4:X:85010195:85049670:-1 gene:ENSRNOG00000013018 transcript:ENSRNOT00000017429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAYCIACPPRKYKSTWGHHRCQT
CITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTF
QLSLVKVDTHTLPPKEATLVALVGSLLVVFALAFLGLFFLYCKQIFNRHCQCGGSLQYEA
EKAVQEDSLLTTPPGQETSPEFPANGSIFEIKPLNSILDDDCSSTRGFPTQESFTMASCA
SESHSQWVHTPIECTELDLQKFSSSVPCPGAETLRENTAEHSGDRLDLYVPFEVPSL
Download sequence
Identical sequences 10116.ENSRNOP00000017429 ENSRNOP00000017429 ENSRNOP00000017429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]