SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000018341 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000018341
Domain Number 1 Region: 159-294
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.06e-28
Family Toll/Interleukin receptor TIR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 8-121
Classification Level Classification E-value
Superfamily DEATH domain 1.85e-25
Family DEATH domain, DD 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000018341   Gene: ENSRNOG00000013634   Transcript: ENSRNOT00000018341
Sequence length 296
Comment pep:known chromosome:RGSC3.4:8:124299729:124303798:-1 gene:ENSRNOG00000013634 transcript:ENSRNOT00000018341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGGPRVGSVSVDSYLFSLPLVALNVGVRRRLSLFLNPRTTAAADWTSLAEEMGFEYLE
IREFETRPDPTRSLLDAWQGRSGSSVGRLLELLALLDREDILYELKDRIEEDCQKYIRNQ
QKQESEKPLQVARVESSVPQTKELGGITTLDDPLGQTPELFDAFICYCPSDIEFVQEMIR
QLEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGVQQKRLIPIKYKAMKKDFPSILRFITICDYTNPCTKSWFWTRLAKALSLP
Download sequence
Identical sequences Q6Y1S1
XP_006244149.1.100692 10116.ENSRNOP00000018341 ENSRNOP00000018341 ENSRNOP00000018341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]