SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000018406 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000018406
Domain Number 1 Region: 234-449
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-61
Family DBL homology domain (DH-domain) 0.0000000571
Further Details:      
 
Domain Number 2 Region: 435-588
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-46
Family Pleckstrin-homology domain (PH domain) 0.00000146
Further Details:      
 
Domain Number 3 Region: 133-258
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-23
Family SH3-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000018406   Gene: ENSRNOG00000013707   Transcript: ENSRNOT00000018407
Sequence length 656
Comment pep:known chromosome:RGSC3.4:15:39794494:39849214:1 gene:ENSRNOG00000013707 transcript:ENSRNOT00000018407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPASVTTTSQDPCTSSGCPRGGRRRRPISVIGGVSFYGNTQAEDVENLLVQPAARPPVP
AHQVPPYKAVSARLRPFTFSQSTPIGLDRVGRRRQMKTSNVSSDGGAESSALVDDNGSEE
DFSYEELCQANPRYLQPGGEQLAINELISDGSVVCAEALWDHVTMDDQELGFKAGDVIQV
LEASNKDWWWGRNEDKEAWFPASFVRLRVNQEELPEPCSSSQGEEQDEDASKARHKHPES
QQQMRTNVIQEIMNTERVYIKHLKDICEGYIRQCRKHTGMFTVGQLATIFGNIEDIYKFQ
RKFLKDLEKQYNKEEPHLSEIGSCFLQHQEGFAIYSEYCNNHPGACVELSNLMKQSKYRH
FFEACRLLQQMIDIALDGFLLTPVQKICKYPLQLAELLKYTTQEHSDYNNIKAAYEAMKN
VACLINERKRKLESIDKIARWQVSIVGWEGLDILDRSSELIHSGELTKITRQGKTQQRVF
FLFDHQLVSCKKDLLRRDMLYYKGRMDMDEVDIVDVEDGRDKDWNLSMRNAFKLVSKATD
EVHLFCARKQEDKARWLQAYADERRRVQEDQQMGMEISENQKKLAMLNAQKAGHGKSKGY
NSCPVAPPHQSLPPLHQRHITVPTSIPQQQVFALAEPKRKPSLFWHTFHKLTPFRK
Download sequence
Identical sequences 10116.ENSRNOP00000018406 ENSRNOP00000018406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]