SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000019087 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000019087
Domain Number 1 Region: 625-689,846-1186
Classification Level Classification E-value
Superfamily Ras GEF 4.32e-118
Family Ras GEF 0.0000137
Further Details:      
 
Domain Number 2 Region: 224-447
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-43
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 23-132
Classification Level Classification E-value
Superfamily PH domain-like 2.01e-17
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 
Domain Number 4 Region: 435-590
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000232
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000019087   Gene: ENSRNOG00000013818   Transcript: ENSRNOT00000019087
Sequence length 1189
Comment pep:known chromosome:RGSC3.4:2:22113649:22360970:-1 gene:ENSRNOG00000013818 transcript:ENSRNOT00000019087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKAAEASRWHEKWFALYQNVLFYFEGEQSG
RPAGMYLLEGCSCERTPAPPRTNAGPAGARDALDKQYYFTVLFGHEGQKPLELRCEEEQA
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIVALNKTKERMRPYHTHQEEEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARLANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEGNPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTFHRKSLPTCYLCDKWLGSDDDT
KGPGHMFGHLDFKIVVEPPDAAPFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVRSLELFFATSQNNREHLVDGKSPRL
CRKFSSPPPLAVSRTSSPVRARKLSLTSSLNSRIGALDLTTSSSSSSPTTVHSPAASPPP
HTAVPESAPADRAGDSTDMSPCRSPSTTPRHLRYRQPGGQVADSTHCAVSPASAFAIATA
AAGHGSPPGFNNERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLE
EVLRDPDLLPQERKATANILRALSQDDQDDIHLKLEDIIQMTDCPKAECFETLSAMELAE
QITLLDHIVFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNEMSNLVASQIMNYADIS
SRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWTKVSKQTKALMDKLQK
TVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHI
IREIRQFQQTAYRIDQQPKVIQYLLDKALVIDEDTLYELSLKIEPRLPA
Download sequence
Identical sequences ENSRNOP00000019087 10116.ENSRNOP00000019087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]