SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000019808 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000019808
Domain Number 1 Region: 617-678,718-867
Classification Level Classification E-value
Superfamily RNI-like 2.35e-34
Family 28-residue LRR 0.00089
Further Details:      
 
Domain Number 2 Region: 15-99
Classification Level Classification E-value
Superfamily DEATH domain 8.36e-20
Family Pyrin domain, PYD 0.0015
Further Details:      
 
Domain Number 3 Region: 189-366
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000741
Family Nucleotide and nucleoside kinases 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000019808   Gene: ENSRNOG00000014685   Transcript: ENSRNOT00000019808
Sequence length 883
Comment pep:known chromosome:RGSC3.4:1:201085759:201091919:1 gene:ENSRNOG00000014685 transcript:ENSRNOT00000019808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAGASCSSSEAVARELLLAALQDLSQEQLKRFRHKLRDAPLDGRSIPWGRLEHSDAVD
LTDKLIEFYAPEPAVDVTRKILKKADIRDVSLRLKEQQLQRLGSSSALLTVSEYKKKYRE
HVLRQHAKVKERNARSVKINKRFTKLLIAPGSGAGEDELLGTSGEPEPERARRSDTHTFN
RLFRGNDDEGPRPLTVVLQGPAGIGKTMAAKKILYDWAGGKLYHSQVDFAFFMPCGELLE
RPGTRSLADLILEQCPDRTAPVRRILAQPHRLLFILDGADELPTLAAPEATPCRDPFEAT
SGLRVLSGLLSQELLPSARLLVTSRNATLGRLQGRLCSPQCAEVRGFSDKDKKKYFFKFF
RDERKAERAYRFVKENETLYALCFVPFVCWIVCTVLLQQMELGRDLSRTSKTTTSVYLLF
ITSMLKSAGTNGPRVQGELRMLCRLAREGILKHQAQFSEKDLERLKLQGSQVQTMFLSKK
ELPGVLETVVTYQFIDQSFQEFLAALSYLLDAEGAPGNSAGSVQMLLNSDAGLRGHLALT
TRFLFGLLSTERIRDIGNHFGCVVPGRVKQDTLRWVQGQSQPKVATVGAEKKDELKDEEA
EEEEEEEEEEEEELNFGLELLYCLYETQEDDFVRQALSSLPEMVLERVRLTRMDLEVLSY
CVQCCPDGQALRLVSCGLVAAKEKKKKKKSFMNRLKGGATDVNLVLSLSSQSTGKQPPAS
LLRPLCEAMITQQCGLSILTLSHCKLPDAVCRDLSEALKVAPSLRELGLLQNRLTEAGLR
LLSQGLAWPKCKVQTLRIQMPGLQEVIHYLVIVLQQSPVLTTLDLSGCQLPGTVVEPLCS
ALKHPKCGLKTLSLTSVELTENPLRELQAVKTLKPDLAIIHSK
Download sequence
Identical sequences 10116.ENSRNOP00000044415 ENSRNOP00000019808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]