SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022203 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000022203
Domain Number - Region: 60-115
Classification Level Classification E-value
Superfamily DEATH domain 0.000147
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022203   Gene: ENSRNOG00000016560   Transcript: ENSRNOT00000022203
Sequence length 203
Comment pep:known chromosome:RGSC3.4:17:21397014:21403216:1 gene:ENSRNOG00000016560 transcript:ENSRNOT00000022203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAFMAVVSPSWRRPCSIPLTLDQTYCDRLVQDTPFLTGQGRLSEQQVDRIILQLNRYYP
QILTNKEAEKFRNPKASLHIRLCDLLSHLQQRGERHCQEFYRALYIHAQPLHSHLPSRYT
PHNSDCRELDWGIERRELSDRGPMSFLAGLGLAAGLALLLYCCPPDPKVLPGTRRVLAFS
PVIIDRHASRYLLAFLADDFGGL
Download sequence
Identical sequences D3ZPP9
NP_001128044.1.100692 NP_001128044.1.4139 ENSRNOP00000022203 ENSRNOP00000022203 10116.ENSRNOP00000022203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]