SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026112 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026112
Domain Number 1 Region: 302-471
Classification Level Classification E-value
Superfamily Sec7 domain 5.23e-56
Family Sec7 domain 0.0000608
Further Details:      
 
Domain Number 2 Region: 514-647
Classification Level Classification E-value
Superfamily PH domain-like 1.96e-26
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026112   Gene: ENSRNOG00000019177   Transcript: ENSRNOT00000026112
Sequence length 772
Comment pep:known chromosome:RGSC3.4:18:28596136:28647134:1 gene:ENSRNOG00000019177 transcript:ENSRNOT00000026112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEKLPSDLHKEEGAIQDHSLEPEEGPGVQNGTAASESLNSHVISPVSEKTGTLEGTME
PVGNPDVALPGLSLSLTNGLALGQDGNILEDSVESRPWRASGPAEEEDTPRSLCLDAEDT
QLGLDCPGEPDVRDGFSATFEKILESELLRGTQYSSLDSLDVLSLTDESDSCVSFEAPLT
PLIQQRARDSPEPAGLGIGDIGPEGDLGAAGGGDGELGSPLRRSISSSRSENVLSHLSLT
SMPNGFHEDEPGGSGGDDEDDEDTDKVLNSASDTSLKDGLSDSDSELSSSEGLEPGSTDP
MANGCQGVSEAARRLARRLYHLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFDFSGLTLD
RALRTFLKAFPLMGETQERERVLTHFSRRYCQCNPDDSTSEDGIHTLTCALMLLNTDLHG
HVNIGKKMSCQQFIANLDQLNDGQDFAKDLLKTLYNSIKNEKLEWAIDEDELRKSLSELV
DDKFGTGTKKVTRILDGGNPFLDVPQALSATTYKHGVLTRKTHADMDGKRTPRGRRGWKK
FYAVLKGTILYLQKDEYRPDKALSEGDLKNAIRVHHALATRASDYSKKSNVLKLKTADWR
VFLFQAPSKEEMLSWILRINLVAAIFSAPAFPAAVSSMKKFCRPLLPSCTTRFCQEEQLR
SHENKLRQVTAELAEHRCHPLERGLKSKEAEEYRLKEHYLTFEKSRYETYIHLLAVKIKV
GSDDLERIEARLATLEGEDPALRKTHSSPALSLGHGPVTGSKAAKDASASDT
Download sequence
Identical sequences ENSRNOP00000026112 10116.ENSRNOP00000061880 XP_006254639.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]