SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026184 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026184
Domain Number 1 Region: 49-102
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000989
Family TNF receptor-like 0.0042
Further Details:      
 
Domain Number 2 Region: 101-139,167-184
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000177
Family TNF receptor-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026184   Gene: ENSRNOG00000019264   Transcript: ENSRNOT00000026184
Sequence length 416
Comment pep:known chromosome:RGSC3.4:4:161431864:161438265:-1 gene:ENSRNOG00000019264 transcript:ENSRNOT00000026184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPGASSPCGLVWGPLLLGFCGLLVASQPQLVPPYRIENQTCWDPDKEYYEPLHQVCCS
RCPPGKFVHAVCSPSQDTVCKTCLHNSYNEHWNHLFSCQLCRPCDSVLGFEEIAPCTSDR
KPECRCKPGMSCVYLDNECVHCEEERLVLCRPGTEAEVTDEIMDTEVNCVPCKPGHFQNT
SSPRARCQPHTRCESQGLVEAASGTSYSDTICKNPPEAAGTMLLLAILLSLVFFLLFTTV
LACAWMRHPSLCRKLGTLLKRHPEGEESPPCQPPRANPHFRDLAEPLLPMSGDLSPAPAG
PPTAPSLEEVVLQQQSPLIQARELEAEPGEHGQVAHGANGIHVTGGSVTVTGNIYIYNGP
VLGGTRGPGDPPAPPEPPYPTPEEGAPGPSELSTPYQEDGKAWHLAETETLGCQDL
Download sequence
Identical sequences Q5U2S8
10116.ENSRNOP00000026184 NP_001008316.1.100692 NP_001008316.1.4139 ENSRNOP00000026184 ENSRNOP00000026184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]