SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026441 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026441
Domain Number 1 Region: 150-370
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-49
Family DBL homology domain (DH-domain) 0.0004
Further Details:      
 
Domain Number 2 Region: 373-505
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-22
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026441   Gene: ENSRNOG00000019528   Transcript: ENSRNOT00000026441
Sequence length 784
Comment pep:known chromosome:RGSC3.4:4:162185252:162201845:-1 gene:ENSRNOG00000019528 transcript:ENSRNOT00000026441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTFDPPNEGPLQGLVASRIETYGGRHQTSAQSSAGITYPRGGPALDLSRRRLQHYVPFA
KGSGQTRGLSPQEPDPEKRHGNYFGVGSPYFPKFKEVSKAHELEVRLHTFSMFGMPRLPP
EDRRHWEIGEGGDSALTIEKSWKELVLGHKEMNRELCHQQEALWELLTTELIYLRKLKIM
TDLLAAGLLNLQRVGLLTEVSAETLFGNVPKLIRTHRRFWEEVLQPILEDTRTSGQPLDP
VSLQNGFLTFGQRFQPYIQYCLRVKQTMAYAREQQDTNPLFRTFVQWCEKHKRSGRQTLG
DLLIKPHQRITKYPLLLQAVLKRSPEPRAQLALDNMIVAVESFLQHINGLVRRGEEQESL
MAVAQRIGPYEVLEPSSEEVEKHLRQFSTLDLMTPIEGVAPENTRQLCWKGPVRMKEGRE
GKMDVYLFLFSDVLLVTKPQRKVDKAKVIRPPLMLEKLVCRPLRDPHSFLLIHLTEFQCV
SSALTVHCSSSTERTQWLQKTQQAQATLQKLKAEEYVQQKRGLLALYRDQGRESPSPRPS
TPSPEDSQSSAEGRALEFTVIPRLVVTEDTDEDTPSVTDDTSDSGYGTLIPSSPKDSQSP
LNRLRSKALRRDPRLTFSTLELRDVPLRPQPPDPQALQRRSAPEMPEGILRGGSLPRRAP
PTWSEEEDETLTPGNVVVETLSRAQRRSPLPHSPAHTDSAGESPWESTDEDEGPLSPGLR
PRSLRAEDMLREIREELASQRIEGALEPEPGNGKLRRLTRAQLQRMRGHHVIQLDTPMST
SSEV
Download sequence
Identical sequences 10116.ENSRNOP00000026441 ENSRNOP00000026441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]