SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Rattus norvegicus 69_3.4 > ENSRNOP00000027251

Domain assignment for ENSRNOP00000027251 from Rattus norvegicus 69_3.4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSRNOP00000027251
Domain Number 1	Region: 25-77
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	2.98e-17
Family	TNF receptor-like	0.00017
Further Details:

Domain Number 2	Region: 78-138
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.000000000000989
Family	TNF receptor-like	0.0001
Further Details:

Domain Number 3	Region: 140-163
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.0000000324
Family	TNF receptor-like	0.0016
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSRNOP00000027251 Gene: ENSRNOG00000020106 Transcript: ENSRNOT00000027251
Sequence length	271
Comment	pep:known chromosome:RGSC3.4:5:172856351:172859041:1 gene:ENSRNOG00000020106 transcript:ENSRNOT00000027251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MYVWVQQPTAFLLLGLSLGVTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCH PCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGV DCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTT FRPTTVPSTTVWPRTSQLPSTPTLVAPEGPAFAVILGLGLGLLAPLTVLLALYLLRKAWR SPNTPKPCWGNSFRTPIQEEQTDTHFTLAKI
Download sequence
Identical sequences	P15725 ENSRNOP00000027251 ENSRNOP00000027251 10116.ENSRNOP00000027251 NP_037181.1.100692 NP_037181.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]