SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028302 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028302
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily DEATH domain 3.14e-35
Family DEATH domain, DD 0.004
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000028302
Domain Number - Region: 108-183
Classification Level Classification E-value
Superfamily DEATH domain 0.00282
Family DEATH domain, DD 0.0000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028302   Gene: ENSRNOG00000020861   Transcript: ENSRNOT00000028302
Sequence length 208
Comment pep:known chromosome:RGSC3.4:1:205009566:205012786:-1 gene:ENSRNOG00000020861 transcript:ENSRNOT00000028302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFLVLLHSLSSSLSGNDLTDLKFLCRERVSKRKLERVQSGLDLFSVLLEQNDLERGHT
GLLRELLASLGRHDLLQRLDDFEAGATTAATPGEADLRVAFDIVCDNVGRDWKRLARELK
VSEAKIDGIEERYPRSLSDRVRETLRVWKNVEKENASVAGLVKALRACRLNLVADLVEEA
LMAQGSVSKSDDTSSALRDSTVSFSETP
Download sequence
Identical sequences Q8R2E7
10116.ENSRNOP00000028302 NP_690920.1.100692 NP_690920.1.4139 ENSRNOP00000028302 ENSRNOP00000066289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]