SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028588 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028588
Domain Number 1 Region: 58-251
Classification Level Classification E-value
Superfamily Sec7 domain 8.63e-79
Family Sec7 domain 0.00000000527
Further Details:      
 
Domain Number 2 Region: 260-375
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-34
Family Pleckstrin-homology domain (PH domain) 0.000000718
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028588   Gene: ENSRNOG00000021051   Transcript: ENSRNOT00000028588
Sequence length 400
Comment pep:known chromosome:RGSC3.4:1:96284658:96291450:-1 gene:ENSRNOG00000021051 transcript:ENSRNOT00000028588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQ
RNRKMAMGRKKFNMDPKKGIQFLVEHELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREE
LNLSVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQ
STDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEDLLRNLYDSIRN
EPFKIPEDDGNDLTHTFFNPDREGWLLKLAGGRVKTWKRRWFILTDNCLYYFEYTTDKEP
RGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPT
QEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
Download sequence
Identical sequences F1LSU6 P63034
ENSRNOP00000028588 10116.ENSRNOP00000028588 ENSMUSP00000051423 ENSRNOP00000028588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]