SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000029803 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000029803
Domain Number 1 Region: 27-81
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000212
Family TNF receptor-like 0.0068
Further Details:      
 
Domain Number 2 Region: 80-132
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000255
Family TNF receptor-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000029803   Gene: ENSRNOG00000027466   Transcript: ENSRNOT00000038023
Sequence length 251
Comment pep:known chromosome:RGSC3.4:4:161351800:161356688:-1 gene:ENSRNOG00000027466 transcript:ENSRNOT00000038023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWPPLYWLCMLGTLVGLLATPAPNNCPDRHYWIGAGLCCQMCGPGTFLVKHCDQDRAAA
QCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECTCSKGWQCRDQECTEC
DPPLNPALTSQPSEAPSPQLPPPTHLPYATEKPSWPPQRQLPDSTVYSRLPSQRPLCSSD
CIRIFVTFSSMLLVFVLGGILFFHQRRNHGPNEDSQAVPEELCPYSCPREEEGSVIPIQE
DYRKPEPASYP
Download sequence
Identical sequences Q501W2
10116.ENSRNOP00000029803 NP_001019506.1.100692 NP_001019506.1.4139 ENSRNOP00000029803 ENSRNOP00000029803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]