SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000034356 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000034356
Domain Number 1 Region: 5-40
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000318
Family BAFF receptor-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000034356   Gene: ENSRNOG00000021987   Transcript: ENSRNOT00000035886
Sequence length 184
Comment pep:known chromosome:RGSC3.4:10:4187672:4193420:-1 gene:ENSRNOG00000021987 transcript:ENSRNOT00000035886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQRCFHSEYFDSLLHACKPCRLRCSNPPAPCQPYCDPSMTSSVRGTYTVLWIFLGLTLV
VCLALFTLSFLLRKMNPEALKDKPQSPGHLDGSVQLDKADTERTKSRAGDERILPRSLEY
TVEECTCEDCIKSNPKGDSDHFFPLPAMEEGATILVTTKTGDYGKGMPSALQSVMGMEKP
AHSR
Download sequence
Identical sequences D3ZKQ8
ENSRNOP00000034356 ENSRNOP00000034356 NP_001099231.1.100692 NP_001099231.1.4139 XP_017452543.1.100692 10116.ENSRNOP00000034356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]