SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000034518 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000034518
Domain Number 1 Region: 124-350
Classification Level Classification E-value
Superfamily vWA-like 6.97e-25
Family Integrin A (or I) domain 0.0016
Further Details:      
 
Domain Number 2 Region: 24-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000314
Family Plexin repeat 0.0034
Further Details:      
 
Domain Number 3 Region: 542-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family Integrin beta EGF-like domains 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000034518
Domain Number - Region: 374-459
Classification Level Classification E-value
Superfamily Integrin domains 0.000382
Family Integrin domains 0.0055
Further Details:      
 
Domain Number - Region: 508-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0114
Family Integrin beta EGF-like domains 0.024
Further Details:      
 
Domain Number - Region: 593-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family Integrin beta EGF-like domains 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000034518   Gene: ENSRNOG00000028203   Transcript: ENSRNOT00000032340
Sequence length 701
Comment pep:known chromosome:RGSC3.4:11:36771717:36786106:-1 gene:ENSRNOG00000028203 transcript:ENSRNOT00000032340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLGRCTLLPILAGLLSLGSGEVHEPCTKDKMGTCQDCIQSGPSCAWCQKLNFTGQGEPNS
VHYDTPEQLLLLKGCTSEYLVDPKSLAEPQEDKERDQKPPSPNVTVFLRPGQTATFKVNF
QWTQDNSVNLYFLIGLSGSVQGHHSNIQTLGSDLLQALSEITKSGHSHYRLLAQLLPISW
ATPTPKDMPSHLTPKFSSPLPFFPFSSFYMLKRQDTSSHFQMELKKQLVSGKLDTPPPRT
TGCYGASCHVPDISSPERNHWCNRTRFLVLATDNDFHFAKDKTQGTRQNTSDGHCHLKDS
MYRSPGEPDYQSVVQLVSKRAENNIRPIFMVPSRMVKTYEKLTTFIPKLNIRNLVHASPQ
TCLMQILSPSSYLKLSSRVILDHSTIPSILTITHDSYHSNRTSSTGKSRGNCSHVQINDH
LSLDGNIKALPKCFQEQFFFIQALGFTVRSFPCKCQCREQSRQNSLCGGKGVVECVYRLT
GNFTQQKTEIQKQARTGDKELEGSFQKDNSSVCSGLGYCICGQCVCHTSDIPNQVISGQY
CECDNVNCERYDGQVCGGPWRGLCACSQCSCKDGFEGSACQCRTPTVGCHDRLIECSGHG
RCHCNRCSCDPGYQPPLREECPGCFFPATNQYILIQQCSQTHSHLLLSSCARECWNLLHS
PTPLNDKTRMTEWDSEGCHMTYTLYRQDQDDINPIYIKDSR
Download sequence
Identical sequences 10116.ENSRNOP00000034518 ENSRNOP00000034518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]