SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000034970 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000034970
Domain Number 1 Region: 581-770
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-54
Family DBL homology domain (DH-domain) 0.00000000408
Further Details:      
 
Domain Number 2 Region: 775-915
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-39
Family Pleckstrin-homology domain (PH domain) 0.000000106
Further Details:      
 
Domain Number 3 Region: 273-410
Classification Level Classification E-value
Superfamily Spectrin repeat 1.73e-17
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 1069-1125
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000473
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 5 Region: 27-179
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000196
Family CRAL/TRIO domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000034970   Gene: ENSRNOG00000028426   Transcript: ENSRNOT00000033358
Sequence length 1161
Comment pep:known chromosome:RGSC3.4:16:81365090:81469766:-1 gene:ENSRNOG00000028426 transcript:ENSRNOT00000033358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQRLNAVSKNTDEIMHQDIVPLCAADIQEQLKKRFAYLSGGRGQDGSPVITFPDYPAFS
EIPDKEFQNVMTYLTSIPSLQDAGIGFILVIDRRQDKWTSVKASVLRIAASFPANLQLVL
VLRPTGFFQRTLSDIAFKFNRDEFKMKVPVMMLSSVPELHGYIDKSQLTEDLGGTLDYCH
SRWLCHRTAIESFALMVKQTAQMLQAFGTELAETELPNDVQSTSLVLSAHTEKKAKVKED
LQLALTEGNSILESLREPLAESIVHSVNQDQLDNQATVKRLLTQLNETEAAFDEFWAKHQ
QKLEQCLQLRHFEQGFREVKTALDSMSQKIAAFTDVGNSLAHVQHLLKDLTTFEEKSSVA
VDKARALSLEGQQLIENRHYAVDSIHPKCEELQHLCDHFASEVTRRRDLLSKSLELHSLL
ETSMKWSDEGIFLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNKIYKEYECI
LNQDLLEHVQKVFQKQESTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSPSPSPG
SWRSSENSSSEGNALRRGPYRRAKSEMSEPRQGRTSSTGEEEESLAILRRHVMNELLDTE
RAYVEELLCVLEGYAAEMDNPLMAHLISTGLQNKKNILFGNMEEIYHFHNRIFLRELESC
IDCPELVGRCFLERMEEFQIYEKYCQNKPRSESLWRQCSDCPFFQECQKKLDHKLSLDSY
LLKPVQRITKYQLLLKEMLKYSKHCEGAEDLQEALSSILGILKAVNDSMHLIAITGYDGN
LGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGYE
KAPSYSYKQSLNMTAVGITENVKGDTKKFEIWYNAREEVYIIQAPTPEIKAAWVNEIRKV
LTSQLQACREASQHRALEQSHSLPLPTPASTSPTKGSTRNVKKLEDRKTDPLCLEGCVSS
SLPKPPEKGKDDAVPSSTSESSALSRKRFTLQGLANLKGQKASPTSPDKKAKRHEVKSDP
TPFGLRGWSKTSHSLEAPEEDGGWSSAEELINSSDAEEDGGVGPRKLVPGKYTVLMDGEK
GGSDTLAMRSGDMVEVVEEGTEGLWYVRDLTSSKEGWVPASSLATLLGKSSSAQCLSSSG
KTHCARQLCPEPAKILSPEPV
Download sequence
Identical sequences ENSRNOP00000034970 10116.ENSRNOP00000023352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]