SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000035610 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000035610
Domain Number 1 Region: 79-111
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000895
Family TNF receptor-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000035610   Gene: ENSRNOG00000022012   Transcript: ENSRNOT00000038747
Sequence length 121
Comment pep:known chromosome:RGSC3.4:5:172869196:172871793:1 gene:ENSRNOG00000022012 transcript:ENSRNOT00000038747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAWAMLYGVSLICVLDLGQQSIAEEPSCGPGRVRNGTGTNTRCCSLCGPDKEDCPKGRC
ICVKPEYHCEDPQCKTCKHYPCQPGQRVESQGNIKFGFQCVDCAMGTFSAGREGHCRLWT
K
Download sequence
Identical sequences Q5M835
ENSRNOP00000035610 ENSRNOP00000035610 10116.ENSRNOP00000035610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]