SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000036566 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000036566
Domain Number 1 Region: 53-221
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.4e-46
Family G proteins 0.0000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000036566   Gene: ENSRNOG00000023375   Transcript: ENSRNOT00000037016
Sequence length 259
Comment pep:known chromosome:RGSC3.4:10:64443112:64446638:-1 gene:ENSRNOG00000023375 transcript:ENSRNOT00000037016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNILAPVRRDRVLAELPQCLKKEAALHVRKDFHPRVTCACQEHRTGTVGFKISKVIVVGD
LSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEVLGVPFSLQLWDTAGQERFKCIAST
YYRGAQAIIIVFNLNDVASLEHSKQWLADALKENDPSNVLLFLVGSKKDLSTPAQYSLME
KDALKVAQEIKAEYWSVSSLTGENVREFFFRVAALTFEANVLAELEKSGSRHIGDVVRIN
SDDKNLYLTASKKKATCCP
Download sequence
Identical sequences Q5U1Y1
NP_001012140.1.100692 NP_001012140.1.4139 ENSRNOP00000036566 10116.ENSRNOP00000036566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]