SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000038449 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000038449
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.71e-21
Family THAP domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000038449   Gene: ENSRNOG00000026840   Transcript: ENSRNOT00000037073
Sequence length 220
Comment pep:known chromosome:RGSC3.4:5:169209740:169215409:-1 gene:ENSRNOG00000026840 transcript:ENSRNOT00000037073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKSCAARQCCNRYSSRRKQLTFHRFPFSRPELLREWVLNIGRADFKPKQHTVICSEHFR
PECFSAFGNRKNLKHNAVPTVFAFQNPAQVCPEVGAGGDSSGRNMDATLEELQSPNTEGP
MQQVLPDRQATEAMEAAGLPAGPLGLKRPLPGQPSDHSYALLDLDTLKKKLFLTLKENKR
LRKRLKAQRLLLRRTCGRLRAYREGLRGQRGPQADAAQGC
Download sequence
Identical sequences B0K027
10116.ENSRNOP00000052352 NP_001102165.1.100692 NP_001102165.1.4139 ENSRNOP00000052352 ENSRNOP00000038449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]