SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000038889 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000038889
Domain Number 1 Region: 655-825
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.65e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000714
Further Details:      
 
Domain Number 2 Region: 87-295
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-43
Family DBL homology domain (DH-domain) 0.0004
Further Details:      
 
Domain Number 3 Region: 311-380,438-472
Classification Level Classification E-value
Superfamily PH domain-like 5.45e-20
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 4 Region: 515-621
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000156
Family Synaptotagmin-like (S variant) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000038889   Gene: ENSRNOG00000022216   Transcript: ENSRNOT00000032861
Sequence length 871
Comment pep:known chromosome:RGSC3.4:10:67617776:67760961:1 gene:ENSRNOG00000022216 transcript:ENSRNOT00000032861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGRRRRPLRYQSLAALVEDSQWPFLFLVSDFSYGAEDYDAEGHEEQKGPPEGSETMP
YIDESPTMSPQLSARSQGGGESISPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYIN
QLEALLLPMKPLKATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQV
TMGHLFQKLASQLGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHT
SVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPR
RTAVTTPKGETRQLVKDGFLVEMSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKW
YIPLADLVFPSPEESEASPQVHPFPDHELEDMKVKISALKSEIQKEKANKGQSRAIERLK
KKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLS
SVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEV
DSFGYFVSKAKTRVFRDTTEPKWDEEFEIELEGSQSLRILCYEKCYDKTKVNKDNNEIVD
KIMGKGQIQLDPQTVESKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVK
ISVVTKRERSKVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLM
LSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPN
LITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVM
AQVQVLLYYLQHPPISFAELKRNTLYFSTDV
Download sequence
Identical sequences 10116.ENSRNOP00000052928 ENSRNOP00000038889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]