SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000040728 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000040728
Domain Number 1 Region: 681-947
Classification Level Classification E-value
Superfamily VPS9 domain 4.45e-46
Family VPS9 domain 0.006
Further Details:      
 
Domain Number 2 Region: 431-560
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 3.14e-24
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.013
Further Details:      
 
Domain Number 3 Region: 356-446
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 3.79e-16
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.018
Further Details:      
 
Domain Number 4 Region: 8-214
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000012
Family DBL homology domain (DH-domain) 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000040728   Gene: ENSRNOG00000033921   Transcript: ENSRNOT00000049210
Sequence length 952
Comment pep:known chromosome:RGSC3.4:8:115271908:115286882:1 gene:ENSRNOG00000033921 transcript:ENSRNOT00000049210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSSEETDLLRLEEVFSTTLARTISLILQPLLLADPEPSDPCGKECLRLLQQLHESAQRL
WDVTEQSLLSLRQRLYHPPSMSLEAVLLLNNADYVLQAHMEYIKSYTDCLVVQAFQKVSK
KRSEFWRSQRKALRQLLSSGSSEGSVGTTLCQALRQPLAHHVQKYVLLLLSLRDTLDEHH
PAQQLVMHAVTLFGNLQSFMQQALDQAMATQALWHSLSSRLRDVLCTPTHRLLQDSQDIP
VVVTPLRAERVLLFDDTLVLLQGHNVHTFDLKLVWVDPSQDKCVLHILTPEDEFSFCTRD
PQGQVVWQWKVTQAVCQALCGKKDFPVLGSGREPSVPPECRCLAYTFHREGRLYQATYDG
EWSRAKPHGKGTLKWPDGRNHVGDFYQGLEHGFGICLVPQASEDKFDCYKCHWREGRMCE
YGICEYGTDEVYKGYFQAGVRHGFGVLDSAPQAPQPFRYTGHWERGQRSGYGIEEDRDRG
ERYIGMWQADQRHGPGIVVTQAGVCYQGTFQGDKMAGPGILLCEDDSLYEGTFTRELTLL
GKGKVTFPNGFTLEGSFCSGTDKGLYTQGVLDTTALPPNPSSTRKRQLGLGAFPVESRWQ
GVYSPFRDFLRLGCPGELQEALLGFHVQSSRELRKSQEYLCCERSHPKDCVGSMEDILKE
LLQHRKPKALQQYLRKALSNSRHPLGKLLQTLMLTFQATYSGIGANKHLQAMAQEEVKQH
ARELWAAYRGLLKVALLRQGQTLEEESMETRDLQVHGLLLPLLLPSFYSELFTLYLLLHE
REDGLYSRGIANLSLFPDTKLLEFLDVQKHLWPLKDLRLTSNQRYSLVRDKCFLSATECL
QKIITTVDPREKLEVLEKTYGEIEATVSRVLGREYKLPMDDLLPLLIYVVSRARIQHLGA
EIHLIRDMMDPIHTGGLHDFLLTALESCYEHIQKEDMRLHHLPGHWDARELW
Download sequence
Identical sequences D3ZG75
ENSRNOP00000043561 ENSRNOP00000040728 10116.ENSRNOP00000043561 XP_001076120.3.4139 XP_006226644.1.4139 XP_006226646.1.4139 XP_006226647.1.4139 XP_006226648.1.4139 XP_006226651.1.4139 XP_006244073.1.100692 XP_006244075.1.100692 XP_006244076.1.100692 XP_006244077.1.100692 XP_006244080.1.100692 XP_008756093.1.4139 XP_008764876.1.100692 XP_017451623.1.100692 XP_017459211.1.4139 XP_236654.6.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]