SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Rattus norvegicus 69_3.4 > ENSRNOP00000042371

Domain assignment for ENSRNOP00000042371 from Rattus norvegicus 69_3.4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSRNOP00000042371
Domain Number 1	Region: 363-456
Classification Level	Classification	E-value
Superfamily	DEATH domain	6.28e-23
Family	DEATH domain, DD	0.0000343
Further Details:

Domain Number 2	Region: 101-144
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.00000000000000126
Family	TNF receptor-like	0.00039
Further Details:

Domain Number 3	Region: 44-100
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.0000000000385
Family	TNF receptor-like	0.0000545
Further Details:

Domain Number 4	Region: 145-197
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.00000000033
Family	TNF receptor-like	0.00032
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSRNOP00000042371 Gene: ENSRNOG00000031312 Transcript: ENSRNOT00000048529
Sequence length	461
Comment	pep:known chromosome:RGSC3.4:4:162172542:162185252:1 gene:ENSRNOG00000031312 transcript:ENSRNOT00000048529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MGLPIVPGLLLSLVLLALLMGIHPSGVTGLVPSLGDREKRDNLCPQGKYAHPKNNSICCT KCHKGTYLVSDCPSPGQETVCEVCDKGTFTASQNHVRQCLSCKTCRKEMFQVEISPCKAD MDTVCGCKKNQFQRYLSETHFQCVDCSPCFNGTVTIPCKEKQNTVCNCHAGFFLSGNECT PCSHCKKNQECMKLCLPPVANVTNPQDSGTAVLLPLVIFLGLCLLFFICISLLCRYPQWR PRVYSIICRDSAPVKEVEGEGIVTKPLTPASIPAFSPNPGFNPTLGFSTTPRFSPPVSST PISPVFGPSNWHNFVPPVREVVPTQGADPLLYGSLNPVPIPAPVRKWEDVVAAQPQRLDT ADPAMLYAVVDGVPPTRWKEFMRLLGLSEHEIERLELQNGRCLREAHYSMLEAWRRRTPR HEATLDVVGRVLCDMNLRGCLENIRETLESPAHSSTTHLPR
Download sequence
Identical sequences	A0A0G2JSU9 10116.ENSRNOP00000042371 ENSRNOP00000042371 ENSRNOP00000042371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]