SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000048094 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000048094
Domain Number 1 Region: 110-175
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 1.7e-19
Family AN1-like Zinc finger 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000048094
Domain Number - Region: 1-40
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00342
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000048094   Gene: ENSRNOG00000000539   Transcript: ENSRNOT00000045636
Sequence length 199
Comment pep:known chromosome:RGSC3.4:20:8383832:8523595:1 gene:ENSRNOG00000000539 transcript:ENSRNOT00000045636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLCSKCFADFQKKQPDDDSTPSTSNSQSDLFSEETTSDNNNTSVTTPTLSPSQQSLPTE
LNVTSPSEEECGPCTDTAHVSLITPTKRSCGADSQSESEASPVKRPRLVENPERPEESGR
SKQKSRRRCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRGREEAIMKM
VKLDRKVGRSCQRIGEGCS
Download sequence
Identical sequences ENSRNOP00000048094 10116.ENSRNOP00000048094 ENSRNOP00000048094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]