SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000050503 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000050503
Domain Number 1 Region: 476-660
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-52
Family DBL homology domain (DH-domain) 0.000000186
Further Details:      
 
Domain Number 2 Region: 668-797
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-33
Family Pleckstrin-homology domain (PH domain) 0.0000125
Further Details:      
 
Domain Number 3 Region: 164-304
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000256
Family Spectrin repeat 0.014
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000050503
Domain Number - Region: 41-81
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00196
Family CRAL/TRIO domain 0.015
Further Details:      
 
Domain Number - Region: 264-398
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0671
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000050503   Gene: ENSRNOG00000003435   Transcript: ENSRNOT00000051550
Sequence length 917
Comment pep:known chromosome:RGSC3.4:X:145594582:145647644:-1 gene:ENSRNOG00000003435 transcript:ENSRNOT00000051550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASFPGNLHLVLVLRPTSFLQRTFTDIGFRFSQEDFMLKLPVVMLSSVSDLLTYIDDKQLT
PELGGTLQYCHSEWIIFRNAIEKFAVTVKEMAQMLQSFGTELAETELPDDIPSIEEILAG
RAERYHLLKNDLTTVTKEGKVLLMNLQVPDTEENLSSSHECPQHINGDWQTIKKLLAQVH
DMETAFDGFWEKHQLKMEQYLQLWKFEQEFQEVVTQVEFLLSQQRELGDVTGNLAQVKQR
LKKIEILDDKSQELLAKGRIVILHGHKLASNHHYALDLICQRCNELRYLSDILVNEIRSK
RIQLSRTFKMHRLLQQARQCCDQGECLLANRGMDKFQTKEDAQKALQDVDNFLQMAMPFI
NYDIENLQFEFDVLLSPELKAQMKNIQRKLENIRSVFENQQNAYKISKDRPEGAVQRMIP
APESVMRARTIFFSPKHVKKSWRQIQAQSNVKVQATQDSQEKNFDQPPKLDSSLDILKNH
VLNELIQTERAYVRELFTVLLGYRSEMDNPQMFDLMPPLLRNKKDVLFGNMAEIYEFHNN
IFMSRLEDCSDAPERVGPCFLERKEDFQMYAKYCQNKPRSELIWRKYSECAFFQECQRKL
KHRLGLDSYLLKPVQRITKYQLLLKELLKYSKEGEGTTKLKEALDSMLELLKSVNDSMHQ
TAINGYVGNMNDLGKMILQGAFSVWVGHRKGATKMKDFARFKPMQRHLFLYEKAVMFCKR
RFESGEGADRYPSYSFKHCLKMEEAGITEHVKGDNRKFEIWYGEKEEIYIVQAPNIDVKM
LWLKEIRNILLKQQELLTAKTQQDQLSDQDQLPPQQQNAELCKSSPIFVCHSFRKQEETL
LNAVEAGAEVEQASAMMEVREAALLVQAEANCTTWNGMLPCTEGTAATAEHPCNSLSPNS
DNGEDRSQMRSMSEVQF
Download sequence
Identical sequences ENSRNOP00000050503 10116.ENSRNOP00000050503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]