SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052022 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052022
Domain Number 1 Region: 26-79
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000251
Family TNF receptor-like 0.0016
Further Details:      
 
Domain Number 2 Region: 102-162
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000005
Family TNF receptor-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052022   Gene: ENSRNOG00000018488   Transcript: ENSRNOT00000055148
Sequence length 289
Comment pep:known chromosome:RGSC3.4:3:156092602:156107426:1 gene:ENSRNOG00000018488 transcript:ENSRNOT00000055148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLPQLCALWGCLLTAVHLGQCVTCSDKQYLQGGECCDLCQPGNRLVSHCTALEKTQCQ
PCDSGEFSAHWNREIRCHQHRHCELNQGLQVKKEGTAVSDTVCTCKEGQHCASKECETCA
QHTPCGPGFGVVQMATETTDTVCQPCPVGFFSNGSSLFEKCHPWTSCEDQKLMVLREGTS
QTDTLCGFQPRMRALLVIPVVMVILITIFVVFLYIKKVVKKPKDNEVLPPEARGQDPVEI
EDYPGHNTAAPVQETLHGCQPVAQEDGKESRISVQERQVTGSMALKPLV
Download sequence
Identical sequences Q4QQW2
NP_599187.1.100692 NP_599187.1.4139 ENSRNOP00000052022 10116.ENSRNOP00000052022 ENSRNOP00000052022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]