SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052372 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052372
Domain Number 1 Region: 64-116
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000942
Family TNF receptor-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052372   Gene: ENSRNOG00000036942   Transcript: ENSRNOT00000055507
Sequence length 258
Comment pep:known chromosome:RGSC3.4:5:168071159:168099322:1 gene:ENSRNOG00000036942 transcript:ENSRNOT00000055507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSCYNMVVTVLLVVGTEEVRATRNPCDSCEAGTFCSKYPPVCTSCPPSTYSSTGGQPN
CDICRVCQGYFRFKKPCSSTHNAECECVEGFHCLGPKCTRCEKDCRPGQELTEQASRAAH
PDMFRSQESSTRARPWVRCSLDGRSVLKNGTKEKDVVCGPPVVSLSPSTTPSAVTTPERE
SGERPLQVLTLFLALTLALLLFLIFIILWFSVPKWLRKKFPHIFKQPFKKAVRTAQEEDA
CSCRFPEEEEGGGGSYEL
Download sequence
Identical sequences ENSRNOP00000052372 10116.ENSRNOP00000052372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]