SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053528 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053528
Domain Number 1 Region: 39-157
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.23e-22
Family PAPS sulfotransferase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053528   Gene: ENSRNOG00000037453   Transcript: ENSRNOT00000056689
Sequence length 178
Comment pep:known chromosome:RGSC3.4:8:100498176:100498712:-1 gene:ENSRNOG00000037453 transcript:ENSRNOT00000056689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVVRSRDPKELIAMPFLEAAGHKLGAKKEGMGGPADYHALGAMEVICNSMAKTLQTALQP
PDWLQGHYLVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVS
ARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKSLLRKPRL
Download sequence
Identical sequences ENSRNOP00000053528 10116.ENSRNOP00000053528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]