SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000058765 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000058765
Domain Number - Region: 60-93
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0235
Family TNF receptor-like 0.019
Further Details:      
 
Domain Number - Region: 7-37
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0282
Family L-arabinose binding protein-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000058765   Gene: ENSRNOG00000040319   Transcript: ENSRNOT00000062061
Sequence length 111
Comment pep:known chromosome:RGSC3.4:1:1531451:1534590:-1 gene:ENSRNOG00000040319 transcript:ENSRNOT00000062061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQREMVHEDYDIVHMWNFSQWLGIKVKIGQFNPHFPQGQQLHLYVDMTELARGSRKMPC
SLCTADCHPGFRRIWKEEMAACCFVCSPCPENEIPNETIIFYQYICHTYDY
Download sequence
Identical sequences ENSRNOP00000058765 10116.ENSRNOP00000058765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]