SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Rattus norvegicus 69_3.4 > ENSRNOP00000059580

Domain assignment for ENSRNOP00000059580 from Rattus norvegicus 69_3.4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSRNOP00000059580
Domain Number 1	Region: 40-94
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	5.05e-16
Family	TNF receptor-like	0.00021
Further Details:

Domain Number 2	Region: 93-158
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.000000000419
Family	TNF receptor-like	0.009
Further Details:

Domain Number 3	Region: 142-199
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.0000754
Family	TNF receptor-like	0.019
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSRNOP00000059580 Gene: ENSRNOG00000013820 Transcript: ENSRNOT00000065174
Sequence length	278
Comment	pep:known chromosome:RGSC3.4:5:171728873:171735340:-1 gene:ENSRNOG00000013820 transcript:ENSRNOT00000065174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MEPLPGWESSPWSRADNTFRLVPCVFLLNLLQCISAQPLCRQEEFSVGDECCPMCNPGYH VKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCI SGYFCENQDGGACSTCLPHAACPPGQRVQKRGTYSHDTVCADCLTGTFSLGGTQEECLPW TKCSTFQREVKHGTSSTDTTCSFQTFYIVVVIVGVAIVGAGVVVFLLRKQRQRHTSIVAS ELEAFQQEQQEDAIRFPVIEVGPSVTEEEAAFNCMNSG
Download sequence
Identical sequences	Q5BK53 ENSRNOP00000018492 ENSRNOP00000059580 10116.ENSRNOP00000018492 NP_001015034.1.100692 NP_001015034.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]