SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000060493 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000060493
Domain Number 1 Region: 652-842
Classification Level Classification E-value
Superfamily Sec7 domain 1.13e-65
Family Sec7 domain 0.00000536
Further Details:      
 
Domain Number 2 Region: 850-996
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000013
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000060493   Gene: ENSRNOG00000014083   Transcript: ENSRNOT00000064560
Sequence length 1194
Comment pep:known chromosome:RGSC3.4:4:157814796:157904039:-1 gene:ENSRNOG00000014083 transcript:ENSRNOT00000064560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLLENPVRAVLYLKELTAIVQNQQSLIHTQRQRIDELERRLDELSAENRSLWEHQQLL
QAQPPPGLVPPPSAPLPAPAATAPAATAAQEPLQDHGQLIPATPEPPLQHHGQLLAQPQP
APSSRVQTPQSPHQHPVAPGAVADKEKERPSSCCAAAGALLQHASPAALGKGVLSRRPKN
ETVLHQFCCPAADTEQKPACSDLASQSDGSCAQAGGGMEDSVVAAVAAGRPSAHAPKAQA
PELQQEEERPGAVGSPRAGPLRAASPGQQQPALATALCSHTPAASEYELSLDLKNKQIEM
LEHKYGGHLVSRRAACTIQTAFRQYQLSKNFEKIRNSLLESRLPRRISLRKVRAPTAESL
VAEKALLESCGLLGLPLGRSPSLPPTFAGSLTELEDSFTEQVQSLAKSIDDALSTWSLKT
MCSLQESGAYQLHQALHPSAGQPGLETEAAREPDSGPGSGDEAGSLPQGHSGTLMMAFRD
VTVQIANQNISVSSSTALSVANCLGAQTAQATAEPAAVQTEQGDAATQEVSEVPASELMD
PPVEDSEAAESGAQSAHEPTVAEAVVEEAVATEAEEEEEGAGQAGKGAEAEVGDNSEQLS
SSSASTKSAKSGSEVSAAASKEALQAVILSLPRYHCENPASCRSPTLSTDTLRKRLYRIG
LNLFNINPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNRDVLD
CVVDEMDFSNMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEVVQQFHNPDT
IFILAFAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRELVVGIYERIQQKE
LKSNEDHVTYVTKVEKSIVGMKTVLSMPHRRLVCCSRLFEVTDVNKLQKQAAHQREVFLF
NDLLVILKLCPKKKSSFTYTFCKAVGLLGMRFHLFENEYYSHGITLATPLSGSEKKQVLH
FCALGSDEMQKFVEDLKESIAEVTELEQIRIEWELERQQGTKTLSARSAGAQGDPQSKQG
SPTAKREAMAGEKATESSGEVSIHNRLQTFQHSPKLGVERGAPAPSPPTSPPPPLPPDPQ
PSPLREQPPPLPLPPPTPPGTLVQCQQIVKVIVLDKPCLARMEPLLSQALSCYASSSSDS
CGSTPLRGPGSPVKVIHQPPLPPPPPPYNHPHQFCPPGSLLLRRRYSSGSRSLV
Download sequence
Identical sequences F1LPA3
10116.ENSRNOP00000018902 ENSRNOP00000060493 ENSRNOP00000018902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]