SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000062873 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000062873
Domain Number 1 Region: 443-663
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-52
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 663-786
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000165
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 3 Region: 776-846
Classification Level Classification E-value
Superfamily SH3-domain 0.00000024
Family SH3-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000062873   Gene: ENSRNOG00000023313   Transcript: ENSRNOT00000067935
Sequence length 849
Comment pep:known chromosome:RGSC3.4:5:160095274:160098820:1 gene:ENSRNOG00000023313 transcript:ENSRNOT00000067935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPLWYLPSSRRGPGGPPRRAALESVPKLLSLRPPFLWVSLLFLPDWALPLWPQGPLQGS
SLPRLSTAQPGKCPGGWQRKGGMDCGPPATLQPHLAGPPGTARRPVAVCQQESLSFVELP
TLHPPSPVCVDLFPITPEELQAPGSRWSLATPAPLQGLLWPTSSGGPDTHISTTGGMRPS
RAGSWPHCPGAQPPTLVGPWSSQHMQPQRRASHGGSEKSAWRKMQVYHNEEATGGTEPPM
GLLETGQAVQGQALCAQEPRPQELSGNTRGGLEAQERRRFSASELMTRLHSSLRLGRSTA
PRALTSGSGAGVIREGKLPGREPRRAETRMDSVSLPAPVDLNEVQGGLVEPRLDTNDKPT
QDTNSATERRQSRFLLNSVLYQEYSDVASARELRRQQREEEGPGDGAEGAEEGPGPPRAN
LSPSSSFRAQRSTRGSTFSLWQDIPDVRGSGVLATLSLRDCKLQEAKFELITSEASYIHS
LSVAVGHFLGSVELSECLGTQDKQWLFSKLPEVKSTSERFLHDLEQRLEADVLRFSVCDV
VLHHCPAFRRVYLPYVTNQAYQERTYQRLLLENPKFPGILARLEESPVCQRLPLTSFLIL
PFQRVTRLKMLVENILKRTTPGSQDEDMATKAFSALKELVQECNASVQSMKRTEELIHLS
KKIHFEGKIFPLISQARWLVRHGELVELAPLPAAPPAKLKLSSKAVYLHLFNDCLLLSRR
KELGKFAVFVHANMAELQVRDLSLKLQGIPGHVFLLRLLHGQRARHQLLLRARTESEKQR
WISALRPSSPQEDKEITCDGEDRPQVQCVRTYKALQPDELTLEKTDILAVKTRTSDGWLE
GVRLADGEK
Download sequence
Identical sequences 10116.ENSRNOP00000033283 ENSRNOP00000062873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]