SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000002617 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000002617
Domain Number 1 Region: 317-601
Classification Level Classification E-value
Superfamily Kelch motif 1.26e-61
Family Kelch motif 0.0000811
Further Details:      
 
Domain Number 2 Region: 50-165
Classification Level Classification E-value
Superfamily POZ domain 1.49e-31
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000002617   Gene: ENSRNOG00000001908   Transcript: ENSRNOT00000002617
Sequence length 619
Comment pep:known chromosome:RGSC3.4:11:83221776:83260528:1 gene:ENSRNOG00000001908 transcript:ENSRNOT00000002617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQRGACTMSDVVERSLEGPLALTTDKSSQKRGDFVEILTGEKVKFDDTRLSLILQNGL
ETLREENALTDVILCVDIQEFSCHRVVLAAASNYFRAMFCNDLKEKYEKRIIIKGVDAET
MHTLLNYTYTSKALITKQNVQRVLEAANLFQFLQLVDACASFLTEALNPENCIGILRLAD
THSLDSLKTQVQSYIIQNFVQILNSEEFLELPVDTLYHILRSDDLCVTEESQVFETVMSW
VRHKQSERLCLLPCVLENVRLPLLDPWYFVEMVEADPLIRQCPEVFPLLQEARMYHLSGN
EIISERTKPRMHEFQSEVFMIIGGCTKDERFVAEVTCLDPLRRSRLEVAKLPLTEHELES
ENKKWVEFACVTLKNEVYISGGKETQHDVWKYNSSINKWIQIEYLNIGRWRHKMVVLGGK
VYVIGGFDGLQRINNVETYDPFHNCWSEAAPLLVHVSSFAATSHKKKLYVIGGGPNGKLA
TDKTQCYDPSTNKWVLKSAMPVEAKCINAVSFQDHIYVVGGAMRALYAYSPLEDSWCLVT
QLSHERASCGIAPCNNKLYITGGRDEKNEVIATVLCWDPEAQKLTEECVLPRGVSHHGSV
TIRKSYTHIRRVVPGAVSV
Download sequence
Identical sequences D4A1Z1
10116.ENSRNOP00000002617 NP_001099337.1.100692 NP_001099337.1.4139 ENSRNOP00000002617 ENSRNOP00000002617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]