SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003660 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003660
Domain Number 1 Region: 35-447
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.94e-81
Family L-arabinose binding protein-like 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000003660
Domain Number - Region: 465-513
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00487
Family TNF receptor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003660   Gene: ENSRNOG00000038492   Transcript: ENSRNOT00000003660
Sequence length 565
Comment pep:known chromosome:RGSC3.4:1:70200168:70219338:-1 gene:ENSRNOG00000038492 transcript:ENSRNOT00000003660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANFIDPWCFWRINLNDVKDKYLDISCAFILAAVQLPVEKDYFNQTLNVLKTMKNNRYAL
ALAFSMDEVNKNPDILPNMSLVIKHTLNYCDGKTALHVVKEKFYRPLPNYVCKEETMCSF
LLTGNWISSIKLFRNLDTFLFPRMTPKDTSLALAIVSFILYFNWNWVGLFISDDDEGNQF
LSELKKETQNKEICFAFVNMMAIIDFIFYQKTEMYYNQIVMSSTNVIIIYGETDSIIELS
FRMWESPVIQRIWVTKSELDFPTSKRDLTRGKFYGTMTFQHHHGEISGFKHFVETWSHLR
SIDLKTLIPEWNYFNYEASASNCKILRNFSSNASLKWLTEQKFHMVFNDISHSIYNAVYA
IAHALQENKLQEVDNQELRHGTYCHCSTLISFIRKTHFTNPLGDRVIIKQRERVLEDYDI
VHIQNFSQRLRIKVKIGKFSPYFPHGGPFHIYGDMTELATGSRKMTSSACSVDCSPGFRK
IWKEGMAACCFVCSPCPENKISNETNFEQCVNCPEYQYANTEKNRCIHKSVFFLSYEDPG
DVSCLKSLLFFCLHSCGTLGLCEAP
Download sequence
Identical sequences 10116.ENSRNOP00000003660 ENSRNOP00000003660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]