SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003789 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003789
Domain Number 1 Region: 10-369
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.38e-126
Family Motor proteins 0.000000373
Further Details:      
 
Domain Number 2 Region: 1061-1123
Classification Level Classification E-value
Superfamily SET domain 0.0000425
Family Histone lysine methyltransferases 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003789   Gene: ENSRNOG00000038035   Transcript: ENSRNOT00000003789
Sequence length 1231
Comment pep:known chromosome:RGSC3.4:X:88624349:88741527:1 gene:ENSRNOG00000038035 transcript:ENSRNOT00000003789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEEVKGIPVRVALRCRPLVSKEINEGCQTCLSFVPGEPQVVVGTDKSFTYDFVFDPSTE
QEEVFNTAVAPLIKGVFKGYNATVLAYGQTGSGKTYSMGGAYTAEQEHDSAIGVIPRVIQ
LLFKEINKKTDFEFTLKVSYLEIYNEEILDLLCSSREKASQINIREDPKEGIKIVGLTEK
TVLVASDTVSCLEQGNNCRTVASTAMNSQSSRSHAIFTISIEQRKKNDKNSSFRSKLHLV
DLAGSERQKKTKAEGDRLKEGININRGLLCLGNVISALGDDKKGNFVPYRDSKLTRLLQD
SLGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNKPIINIDPQAAELNHLKQQVQ
QLQVLLLQAHGGTLPGNINVKPSENLQSLMEKNQSLVEENEKLSRGLSEAAGQTAQMLER
IILTEQANEKMNAKLEELRQHAACKVDLQKLAETLEDQEVKENIEIICNLQQAIARLSDE
AVACMTATIDTAGEVDTQEQSSPDTSRSSDVFSTQHALRQAQMSKELIELNKELALKEAL
AKKMTQNDNQLQPIQFQYQDNIKNLELEVLSLQKEKEELVLELQTAKKDVNQAKLSERRR
KRLQELEGQIAELKKKLHEQSKLLKLKETTELTVSKLNQEIRMMKNQRVQLMRQMKEDAE
KFRQWKQQKDKEVIQLKERDRKRQYELLKLERNFQKQSNVLRRKTEEAAAANKRLKDALQ
KQKEVAEKRKETQSRGMEGTAARMKSWLGNEIEVMVSTEEAKRHLNDLLEERKILAQDVA
QLKEKRESGENPPPKLRRRTFSRDEVHGQDSGAEDSISKQIESLESELELRSAQIADLQQ
KLLDAESEDQPKQRWENIATILEAKCAIKYLVGELVSSKIQVSKLESGLSQSKASCIEVQ
KMLFEEQNHFAKIETELKEELVRVEQQHQEKVLYLLSQLQQCQVTEKQLEESVSEKEQQL
LSTLKCQEEELRKMQEVCEQNQQLLQENSAIKQKLNLLQVVSKEKPHLVRNILQSPDSSF
EYIPPKPKPFRIKEKCPEKSFAIEDLQYYSETSVAEEENEDSDDHADEEWIPTKLVKVSK
KNIQGCSCKGWCGNKQCGCRKQKSDCNGACSCDPTKCRNRHHSQDNSDVIELNQDSENSF
KLEDPTEVTSGLSFFNPVCTTPSSKILKEMCDADQVLLRQPDFASSSDHLELKPIASETQ
ENKAMGKKKKRALASNTSFFSGCSPIQEESH
Download sequence
Identical sequences E9PSJ3
ENSRNOP00000003789 ENSRNOP00000003789 10116.ENSRNOP00000003789 XP_006227433.1.4139 XP_006227434.1.4139 XP_006257175.1.100692 XP_006257176.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]