SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003851 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003851
Domain Number 1 Region: 318-595
Classification Level Classification E-value
Superfamily Kelch motif 4.97e-84
Family Kelch motif 0.000000588
Further Details:      
 
Domain Number 2 Region: 46-163
Classification Level Classification E-value
Superfamily POZ domain 3.3e-36
Family BTB/POZ domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003851   Gene: ENSRNOG00000002875   Transcript: ENSRNOT00000003851
Sequence length 609
Comment pep:known chromosome:RGSC3.4:13:76655800:76700630:-1 gene:ENSRNOG00000002875 transcript:ENSRNOT00000003851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGKPMRRCTNIRPGETGMDVTSRCTLGDPNKLPEGVPQPARMPYISDKHPRQTLEVINL
LRKHRELCDVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAME
LLIDFAYTSQITVEEGNVQTLLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTH
SCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVK
YSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQER
PLMQGPRTRPRKPIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGV
SVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGFLYAVGG
QDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERY
NPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAM
TSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGVGVIK
MTHCESHIW
Download sequence
Identical sequences A0A024R940 A0A096N993 A0A0D9RH98 A0A1S3F3N5 A0A287AB13 A0A2J8UBU4 A0A2K5F5P9 A0A2K5HKQ9 A0A2K5S737 A0A2K5XEY3 A0A2K6DZA0 A0A2K6L563 A0A2K6QRS3 A0A2K6TVJ8 D3Z8N4 F1PCW9 F7FYX2 G3RXB8 G7MFD2 G7NVI1 H2Q0M8 I3MPF4 M3WID1 M3Y007 Q08DK3 Q9Y2M5
ENSBTAP00000033909 ENSPTRP00000002822 ENSP00000209884 ENSRNOP00000003851 ENSP00000209884 ENSTTRP00000008103 ENSCJAP00000017077 ENSPTRP00000002822 10116.ENSRNOP00000003851 9598.ENSPTRP00000002822 9606.ENSP00000209884 9913.ENSBTAP00000033909 ENSP00000209884 ENSBTAP00000033909 ENSMPUP00000004658 ENSMPUP00000004658 NP_001070303.1.59421 NP_001070303.1.76553 NP_001100662.1.100692 NP_001100662.1.4139 NP_055273.2.87134 NP_055273.2.92137 XP_001493064.2.31192 XP_002760404.1.60252 XP_002916995.1.58354 XP_003497710.1.69978 XP_003824721.1.60992 XP_003925402.1.74449 XP_004027970.1.27298 XP_004269818.1.21590 XP_004269819.1.21590 XP_004372882.1.4749 XP_004425086.1.5094 XP_004761990.1.14098 XP_005217118.1.76553 XP_005217119.1.76553 XP_005245150.1.92137 XP_005319848.1.77405 XP_005656773.1.46622 XP_005690944.1.57651 XP_005890898.1.15283 XP_005890899.1.15283 XP_005966355.1.78601 XP_005966356.1.78601 XP_006063710.1.26621 XP_006063711.1.26621 XP_006063712.1.26621 XP_006063713.1.26621 XP_006172633.1.101512 XP_006250174.1.100692 XP_006867116.1.41390 XP_006892690.1.29581 XP_006979654.1.50099 XP_007084075.1.5354 XP_007165403.1.59432 XP_007471663.1.90284 XP_007610840.1.28591 XP_007987646.1.81039 XP_008144085.1.99482 XP_008509366.1.77740 XP_008694677.1.72690 XP_008976570.1.60992 XP_008983248.1.60252 XP_009436754.1.37143 XP_010334414.1.74449 XP_010365669.1.97406 XP_010365670.1.97406 XP_010589308.1.64505 XP_010848370.1.44457 XP_010848371.1.44457 XP_010982842.1.51371 XP_011289206.1.62641 XP_011744333.1.29376 XP_011744335.1.29376 XP_011817726.1.43180 XP_011836795.1.47321 XP_012300051.1.9421 XP_012871246.1.60039 XP_013825848.1.57651 XP_013825850.1.57651 XP_014708371.1.49734 XP_014920126.1.86478 XP_014979337.1.72884 XP_014979343.1.72884 XP_015293965.1.63531 XP_015294342.1.63531 XP_015347288.1.40921 XP_016077063.1.3490 XP_017385452.1.71028 XP_017385453.1.71028 XP_017722417.1.44346 XP_017722418.1.44346 XP_018882286.1.27298 XP_019280765.1.44245 XP_019807642.1.83887 XP_019831844.1.53367 XP_019831845.1.53367 XP_020032438.1.5219 XP_020757917.1.74333 XP_020757919.1.74333 XP_021518253.1.76796 XP_021518261.1.76796 XP_021518262.1.76796 XP_021538293.1.83697 XP_514005.2.37143 XP_537188.2.84170 ENSCJAP00000044149 ENSCAFP00000021453 ENSTTRP00000008103 gi|40807500|ref|NP_055273.2| ENSRNOP00000003851 ENSCAFP00000021453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]