SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005041 from Rattus norvegicus 69_3.4

(show help)
Strong hits

Sequence:	ENSRNOP00000005041
Domain Number 1	Region: 102-144
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	3.33e-16
Family	LIM domain	0.0024
Further Details:

Domain Number 2	Region: 37-83
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	3.83e-16
Family	LIM domain	0.00038
Further Details:

Domain Number 3	Region: 145-190
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000000124
Family	LIM domain	0.00037
Further Details:

Domain Number 4	Region: 8-35
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000205
Family	LIM domain	0.0024
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSRNOP00000005041 Gene: ENSRNOG00000003772 Transcript: ENSRNOT00000005041
Sequence length	193
Comment	pep:known chromosome:RGSC3.4:7:49910221:49929537:1 gene:ENSRNOG00000003772 transcript:ENSRNOT00000005041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKS CYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESAQPHRPTTNPNTSKFAQKYGGAEKCS RCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGF GYGQGAGALVHAQ
Download sequence
Identical sequences	D2HF33 G3V9V9 M3Z197 P97314 ENSMUSP00000129498 ENSMPUP00000017359 ENSMPUP00000017359 ENSAMEP00000006991 ENSRNOP00000061356 NP_031818.3.92730 NP_803174.2.100692 NP_803174.2.4139 XP_002920690.1.58354 XP_004404891.1.74151 XP_004752420.1.14098 XP_004752421.1.14098 XP_006737824.1.47382 XP_008682551.1.72690 XP_008682552.1.72690 XP_008850213.1.79516 XP_008850221.1.79516 XP_008850230.1.79516 XP_017658496.1.79516 XP_021514680.1.76796 XP_021534231.1.83697 10090.ENSMUSP00000020403 10116.ENSRNOP00000061356 ENSAMEP00000006991 ENSMUSP00000020403 ENSMUSP00000020403 ENSRNOP00000005041

SEARCH