SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006992 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006992
Domain Number 1 Region: 429-713
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-83
Family Kelch motif 0.0000014
Further Details:      
 
Domain Number 2 Region: 158-276
Classification Level Classification E-value
Superfamily POZ domain 1.78e-31
Family BTB/POZ domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006992   Gene: ENSRNOG00000005215   Transcript: ENSRNOT00000006992
Sequence length 717
Comment pep:known chromosome:RGSC3.4:X:103218938:103317748:1 gene:ENSRNOG00000005215 transcript:ENSRNOT00000006992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSGKKEFDVKQILRLRWRWFSHPSQGSPNTGSCLQQEGYEHRGTPVQGRLKNHSRDRN
GLKKSNSPVHHDILTPVPGPAPTHQRVLQNWHQQNVIVHLQANEDTPKAVPEGNLLKEAC
EKRARDLEMMGDDNIEDSRARQYAEEPEQMNVISEDHYRSRNHADYTLCKMESYLKEKKL
CDVLLIAGPLKIPAHRLVLSAVSDYFAAMFTNDVLEARQEEVKMEGVDPNALNSLVQYAY
TGVLQLREDTIENLLSAACLLQLTQVIDVCCNFLIKQLHPSNCLGIRSFGDAQGCMELQN
VAHKYTMEHFIDVVKNQEFLLLPANEISKLLCSDDINVPDEETIFHALMQWVGHDAQARQ
QDLAKLLSYIRLPLLSPQLLADLENSSMFSGDLECQKLLMEAMKYHLLPERRSMLQSPRT
KPRKSTVGALYAVGGMDAAKGTTTIEKYDLRTNSWIHIGTMSGRRLQFGVAVVDNKLYVV
GGRDGLKTLNTVECFNPVTKTWVVMPPMSTHRHGLGVATLEGPMYAVGGHDGWSYLNTVE
RWDPDGRQWNYVASMSTPRSTVGVVALNNKLYAIGGRDGSSCLKSMEYFDPHTNKWSLCA
PMSKRRGGVGVATHNGYLYVVGGHDAPAPNHCSRLSDCVERYDPKSDSWSTVAPLSVPRD
AVAVCPLGDKLYVVGGYDGHTYLNTVESYDAQKDEWKEEVPVNIGRAGACVVVVKLH
Download sequence
Identical sequences ENSRNOP00000006992 NP_001101714.1.100692 NP_001101714.1.4139 10116.ENSRNOP00000006992 ENSRNOP00000006992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]