SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000007610 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000007610
Domain Number 1 Region: 22-150
Classification Level Classification E-value
Superfamily Lysozyme-like 5.32e-46
Family C-type lysozyme 0.00000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000007610   Gene: ENSRNOG00000005790   Transcript: ENSRNOT00000007610
Sequence length 151
Comment pep:known chromosome:RGSC3.4:7:56576837:56581709:-1 gene:ENSRNOG00000005790 transcript:ENSRNOT00000007610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALPTLLTLGLLLLSITVQGKVLNRCLLARTLQRFGLGGFKGISLANWICLAKSVSGYD
TKAIKYNHEDRSTNYGIFQISSRYWCNDSKTPGSKNFCRVSCKALLKNNIKASVTCAKRI
VKDPRGITTWEAWRKNCEHKNLFQYVQGCSL
Download sequence
Identical sequences D4A0W2
ENSRNOP00000007610 NP_001102216.1.100692 NP_001102216.1.4139 10116.ENSRNOP00000007610 ENSRNOP00000007610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]