SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000008274 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000008274
Domain Number 1 Region: 37-171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-35
Family Galectin (animal S-lectin) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000008274   Gene: ENSRNOG00000005464   Transcript: ENSRNOT00000008274
Sequence length 172
Comment pep:known chromosome:RGSC3.4:14:101620863:101628365:-1 gene:ENSRNOG00000005464 transcript:ENSRNOT00000008274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSVADSDAVVKLDDGHLNNSLGSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIV
DLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIP
DQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG
Download sequence
Identical sequences A0A2K5UYR9 B4F7A3 E1BKC9 F6QMT0 I3L8J2 I3N9X9 Q8VED9
ENSRNOP00000008274 ENSBTAP00000000179 ENSSTOP00000021176 ENSRNOP00000008274 ENSSSCP00000020352 ENSMUSP00000044342 ENSSSCP00000020352 GO.49308 mmt010014306.1 ENSTTRP00000007554 NP_001128202.1.100692 NP_001128202.1.4139 NP_001192760.1.59421 NP_001192760.1.76553 NP_776113.1.92730 XP_003481250.1.46622 XP_004280678.1.21590 XP_004435681.1.5094 XP_005322124.1.77405 XP_005366514.1.66349 XP_005575805.1.63531 XP_006079873.1.26621 XP_007464176.1.90284 XP_011981169.1.54773 XP_013370195.1.28644 XP_014444699.1.99106 XP_015335094.1.40921 XP_017910910.1.57651 XP_019798449.1.83887 XP_020771882.1.74333 XP_021066521.1.100879 XP_021504140.1.76796 10090.ENSMUSP00000044342 10116.ENSRNOP00000008274 9913.ENSBTAP00000000179 ENSMUSP00000044342 ENSBTAP00000000179 ENSTTRP00000007554 ENSMUSP00000044342 ENSSTOP00000021176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]