SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009054 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009054
Domain Number 1 Region: 425-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-18
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 142-183
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000068
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 
Domain Number 3 Region: 363-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000405
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 304-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000482
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000009054
Domain Number - Region: 46-118
Classification Level Classification E-value
Superfamily Tropomyosin 0.00216
Family Tropomyosin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009054   Gene: ENSRNOG00000006711   Transcript: ENSRNOT00000009054
Sequence length 492
Comment pep:known chromosome:RGSC3.4:4:76049760:76061344:1 gene:ENSRNOG00000006711 transcript:ENSRNOT00000009054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESTPARHRRKRRSTPLAPATPPSQTTEKSQYFQTTEISLWTVVAAIQAVEKKMESQAA
RLQSLEGRAGSAEKKLADFEKTAVEFSNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRN
KNFWVLRLPPGSKGETPKVSGPLENDGVCFSEQEWENLEDWQKELYRNVMESNYETLVSL
KVLGQPEEEVELGAEMVGDLVEEGTHLADRAMVKQEMLYKQEGPSGLPSMFSSAAEPQAC
FGSEQAVFWNSPGDSALLESGPGDSNPESVESSRDPAPGRNLDCPRKQKSHRQVQLGQEC
GQGPKVKRDTSPYKCSECQISFRYKQQLTAHLQSHTSRESYSATEPEESLRPRPRLKPQA
KRSKLHQCDVCHRSFSCKVSLVTHQRCHQQEGPSTSPQIQERFSPNSLVALPGHIPWRKS
RSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCPECEKSFVQKQHLLQHQKIHQRERGG
LASESARPNGLL
Download sequence
Identical sequences G3V6U6
ENSRNOP00000009054 XP_006224968.1.4139 XP_006236507.1.100692 ENSRNOP00000009054 10116.ENSRNOP00000009054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]