SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009893 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009893
Domain Number 1 Region: 186-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-52
Family DBL homology domain (DH-domain) 0.00000171
Further Details:      
 
Domain Number 2 Region: 2-213
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.76e-39
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-32
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 
Domain Number 4 Region: 658-759,836-862
Classification Level Classification E-value
Superfamily SH2 domain 3.15e-24
Family SH2 domain 0.00086
Further Details:      
 
Domain Number 5 Region: 785-864
Classification Level Classification E-value
Superfamily SH3-domain 1.05e-19
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 6 Region: 561-647
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000276
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009893   Gene: ENSRNOG00000007422   Transcript: ENSRNOT00000009893
Sequence length 868
Comment pep:known chromosome:RGSC3.4:3:6153681:6347676:-1 gene:ENSRNOG00000007422 transcript:ENSRNOT00000009893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQSKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEV
QQPMKMGLTEDDKRSCCLLEIQETEAKYYRTLEDIEKNYMGPLRQVLSPVDMATIFINLE
DLIKVHHSFLRAIDVSMMAGGSTLAKVFLEFKERLLIYGEYCSHMEHAQSALNQLLASRD
DFRQKVEECTLKVQEGKFKLQDLLVVPMQRVLKYHLLLKELLSHSADRPERQQLKEALEA
MQDLAMYINEVKRDKETLKKISEFQCSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDR
YLFLFDKVVIVCKRKGYSYELKEVIELLFHKMTDDPMHNKDIKKWSYGFYLIHLQGKQGF
QFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQ
GYLCTRCGVGAHKECLEVIPPCKMSSPADADAPGAGLGPKMVAVQNYHGNPAPPGKPVLT
FQTGDVIELLRGDPDSPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPVGRPPSREIDYTA
YPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDSWIH
ITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKFPYKSRERAATRASSRSPASCASYSF
SFLSPQGLSFAPQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREGDVVKIYSRIG
GDQGWWKGETNGRIGWFPSTYVEEEGIQ
Download sequence
Identical sequences D3ZYG0
ENSRNOP00000009893 10116.ENSRNOP00000009893 ENSRNOP00000009893 NP_001100033.2.100692 NP_001100033.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]