SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010107 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010107
Domain Number 1 Region: 110-373
Classification Level Classification E-value
Superfamily Caspase-like 1.38e-63
Family Caspase catalytic domain 0.000000532
Further Details:      
 
Domain Number 2 Region: 6-81
Classification Level Classification E-value
Superfamily DEATH domain 0.00000181
Family Caspase recruitment domain, CARD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010107   Gene: ENSRNOG00000033697   Transcript: ENSRNOT00000010107
Sequence length 374
Comment pep:known chromosome:RGSC3.4:8:2038603:2075139:1 gene:ENSRNOG00000033697 transcript:ENSRNOT00000010107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENNHPDKPLKVLEELGKEFLTEYLEKLVQSNVLKLKEEEKQKFNNAERSDKRWVFVDV
LKRKHNQVGKMLLQTFLNVDSGSHHGEANLEMEEPEESVDTLKLCSSEEFTRLCREKKQE
IYPIKETNGRTRKALIICNTEFKHLSLRYGANIDISGMKGLLEELGYDVVVKEELTAEGM
ESEMKDFAALSEHQTSDSTFLVLMSHGTLQGLCGTMHSEATPDVLLYDTIYQIFNNCHCP
GLRDKPKVIIVQACRGGNPGEVWIRESSGAHSYRAVDLPRNMEADAVRMSHVEKDFIALY
STTPRHLAYTDWPRGSYXSSKCIFCLRMXTXTVYLYELHKIKVQQSFEKASINSQMPTID
RATLTRYFYLFPGN
Download sequence
Identical sequences 10116.ENSRNOP00000010107 ENSRNOP00000010107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]