SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011344 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011344
Domain Number 1 Region: 207-286
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000471
Family DEATH domain, DD 0.024
Further Details:      
 
Domain Number 2 Region: 103-160
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000576
Family TNF receptor-like 0.0026
Further Details:      
 
Domain Number 3 Region: 32-80
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000138
Family TNF receptor-like 0.0031
Further Details:      
 
Domain Number 4 Region: 290-371
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000841
Family DEATH domain, DD 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011344   Gene: ENSRNOG00000008336   Transcript: ENSRNOT00000011344
Sequence length 401
Comment pep:known chromosome:RGSC3.4:7:90606425:90634431:-1 gene:ENSRNOG00000008336 transcript:ENSRNOT00000011344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKWLCCALLVFLDIIEWTTQETFPPKYLHYDPETGRQLLCDKCAPGTYLKQHCTVRRKT
LCVPCPDYSYTDSWHTSDECVYCSPVCKELQTVKQECNRTHNRVCECEEGRYLELEFCLK
HRSCPPGLGVLQAGTPERNTVCKRCPDGFFSGETSSKAPCRKHTNCSSLGLLLIQKGNAT
HDNVCSGNREATQNCGIDVTLCEEAFFRFAVPTKIIPNWLSVLVDSLPGTKVNAESVERI
KRRHSSQEQTFQLLKLWKHQNRDQEMVKKIIQDIDLCESSVQRHIGHANLTTEQLRILME
SLPGKKISPDEIERTRKTCKPSEQLLKLLSLWRIKNGDQDTLKGLMYALKHLKAYHFPKT
VTHSLRKTIRFLHSFTMYRLYQKLFLEMIGNQVQSVKISCL
Download sequence
Identical sequences O08727
ENSRNOP00000011344 ENSRNOP00000011344 NP_037002.1.100692 NP_037002.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]