SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000012528 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000012528
Domain Number 1 Region: 314-505
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-36
Family SPRY domain 0.00024
Further Details:      
 
Domain Number 2 Region: 28-99
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-19
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 107-170
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000901
Family B-box zinc-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000012528   Gene: ENSRNOG00000009449   Transcript: ENSRNOT00000012528
Sequence length 515
Comment pep:known chromosome:RGSC3.4:15:45730500:45748172:1 gene:ENSRNOG00000009449 transcript:ENSRNOT00000012528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAAASVVTAAAPAMEPGPSVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRRCVS
GCWEVQTTPSCPVCKERAVPGELRTNHTLNNLVETLLREEAEGARWTGRRSPRPCRAHRA
PLTLFCVEDKELLCCACQADARHQEHRVQPIKDTAQDFRAKCKNMEHVLREKAKSFWALR
RTYEAIAKHNEVQTTWLEGRIRDEFDKLRDFLRVEEQATVDAMKEESRKKHLLAEEKMKQ
LAEQTEALAREIERLQMEMKEDDMTFLMKHKSRKRRLFCTVEPAPLQPGLLMDACKYLES
LQYRVWKKMLGSVESVPFSLDPNTAAGWLKVADDLTSVINHGYRVQVENPERFSSAPCLL
GSQVFSKGSHSWEVDVGGLPSWRVGVVRVQAHAQAQAQADVGGEGHSHSCYHDTRSGFWY
LCRTQGVDGDHCMTSDTATAPLVQAMPRRLRVELECEEGELSFYDSERHCHLYTFHAHFG
EVRPYFYLGASRGDGPPEPLRICHLRVSIKEELDI
Download sequence
Identical sequences G3V769
ENSRNOP00000012528 NP_001020313.2.100692 NP_001020313.2.4139 10116.ENSRNOP00000012528 ENSRNOP00000012528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]