SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000012568 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000012568
Domain Number 1 Region: 60-157
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 4.45e-29
Family Cytochrome b5 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000012568
Domain Number - Region: 384-440
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00964
Family Calponin-homology domain, CH-domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000012568   Gene: ENSRNOG00000009399   Transcript: ENSRNOT00000012568
Sequence length 487
Comment pep:known chromosome:RGSC3.4:3:68696498:68735967:-1 gene:ENSRNOG00000009399 transcript:ENSRNOT00000012568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLEEKLEHNESLVGKSRPCLNDTHQANGKHIANGNLRANGNVEVYEKQEANGKGDRLRK
CLNLYTWQEIQKHNQETDQWLVIDRKVYNVTDWAGKHPGGHRVLNHYAGEDATDAFRAMH
LDPSIVQLYLKPLLIGELSPEEPSQEKNKNPQLVEDFRELRKTLEDMNMFSANLWFFFLH
LAQILILEVLAWLILRHFSSGWIVTILISFLLTVSQAQSSFLQHDIGHLSMFKKSKWNHL
MHKFVMCHLKGLSADWWNYRHFQHHVKPNIYPKDPDIDVGPLFLLGDTQPIKYGKKKIKY
IDYEKQHLYFYMVALPLLMPVYFNLQSMQVMYLRKYWTDIVWVSSFYIRYFITFGPFYGI
FGTVLLIYLVKFIESPWIAYVTQMSHIPMKMSREENLDWLSTQIVATCNIEQSFFNDWFT
GHLNFQIEHHLFPTMPRHNYHKVAPLVKSLCTKHGLQYINKPILKAFGDIVRSLKKSAAL
WMDAYYE
Download sequence
Identical sequences D3ZCK6
10116.ENSRNOP00000012568 XP_002726271.1.4139 XP_002729233.1.100692 ENSRNOP00000012568 ENSRNOP00000012568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]