SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000012876 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000012876
Domain Number 1 Region: 256-512
Classification Level Classification E-value
Superfamily Kelch motif 1.23e-32
Family Kelch motif 0.0048
Further Details:      
 
Domain Number 2 Region: 48-155
Classification Level Classification E-value
Superfamily POZ domain 8.57e-32
Family BTB/POZ domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000012876   Gene: ENSRNOG00000009397   Transcript: ENSRNOT00000012876
Sequence length 534
Comment pep:known chromosome:RGSC3.4:3:75263493:75268812:1 gene:ENSRNOG00000009397 transcript:ENSRNOT00000012876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGGNADSWQKEKLATMESPEEPGASMDENYFVNYTFKDRSHSGRVAQGIMKLCLEEELF
ADVTISVEGREFQLHRLVLSAQSCFFRSMFTSNLKEAHNRVIVLQDVSESVFQLLVDYIY
HGTVKLRADELQEIYEVSDMYQLTSLFEECSRFLARTVQVGNCLQVMWLADRHSDPELYT
AAKHCAKTHLAQLQSTEEFLHLPHHLLTDIISDGVPCSQNPTEAIDAWINFNKEEREAFA
ESLRTSLKEIGENVHIYLIGKESSRTHSLAVSLHCAEDDSISVSGQNSLCHQITAACKHG
GDLYVVGGSIPRRMWKCNNATVDWEWCAPLPRDRLQHTLVSVPGKDAIYSLGGKTLQDTL
SNAVIYYRVGDNVWTETTQLEVAVSGAAGANLNGIIYLLGGEENDLDFFTKPSRLIQCFD
TETDKCHVKPYVLPFAGRMHAAVHKDLVFIVAEGDSLVCYNPLLDSFTRLCLPEAWSSAP
SLWKIASCNGSIYVFRDRYKKGDANTYKLDPATSAVTVTRGIKVLLTNLQFVLA
Download sequence
Identical sequences 10116.ENSRNOP00000012876 ENSRNOP00000012876 XP_006234569.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]