SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013385 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013385
Domain Number 1 Region: 29-486
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.18e-94
Family L-arabinose binding protein-like 0.0000833
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000013385
Domain Number - Region: 494-538
Classification Level Classification E-value
Superfamily TNF receptor-like 0.008
Family TNF receptor-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013385   Gene: ENSRNOG00000009708   Transcript: ENSRNOT00000013385
Sequence length 840
Comment pep:known chromosome:RGSC3.4:5:169256281:169268006:-1 gene:ENSRNOG00000009708 transcript:ENSRNOT00000013385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFWAAHLLLSLQLVYCWAFSCQRTESSPGFSLPGDFLLAGLFSLHGDCLQVRHRPLVTS
CDRPDSFNGHGYHLFQAMRFTVEEINNSSALLPNITLGYELYDVCSESANVYATLRVLAL
QGPRHIEIQKDLRNHSSKVVAFIGPDNTDHAVTTAALLGPFLMPLVSYEASSVVLSAKRK
FPSFLRTVPSDRHQVEVMVQLLQSFGWVWISLIGSYGDYGQLGVQALEELAVPRGICVAF
KDIVPFSARVGDPRMQSMMQHLAQARTTVVVVFSNRHLARVFFRSVVLANLTGKVWVASE
DWAISTYITSVTGIQGIGTVLGVAVQQRQVPGLKEFEESYVRAVTAAPSACPEGSWCSTN
QLCRECHTFTTRNMPTLGAFSMSAAYRVYEAVYAVAHGLHQLLGCTSEICSRGPVYPWQL
LQQIYKVNFLLHENTVAFDDNGDTLGYYDIIAWDWNGPEWTFEIIGSASLSPVHLDINKT
KIQWHGKNNQVPVSVCTTDCLAGHHRVVVGSHHCCFECVPCEAGTFLNMSELHICQPCGT
EEWAPKESTTCFPRTVEFLAWHEPISLVLIAANTLLLLLLVGTAGLFAWHFHTPVVRSAG
GRLCFLMLGSLVAGSCSFYSFFGEPTVPACLLRQPLFSLGFAIFLSCLTIRSFQLVIIFK
FSTKVPTFYRTWAQNHGAGLFVIVSSTVHLLICLTWLVMWTPRPTREYQRFPHLVILECT
EVNSVGFLLAFTHNILLSISTFVCSYLGKELPENYNEAKCVTFSLLLNFVSWIAFFTMAS
IYQGSYLPAVNVLAGLTTLSGGFSGYFLPKCYVILCRPELKNTEHFQASIQDYTRRCGTT
Download sequence
Identical sequences 10116.ENSRNOP00000013385 ENSRNOP00000013385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]